DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and cryabb

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:93 Identity:44/93 - (47%)
Similarity:58/93 - (62%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ 150
            ||.|.:.:||..|.|.||:||::.|.|.:..|||:|||.||.:.|.|:|:|:||.|.....:.|.
Zfish    61 KDQFSLSLDVKHFAPEELSVKIIGDFIEIHAKHEDRQDGHGFVSREFLRKYRVPVGVDPASITSS 125

  Fly   151 LSSDGVLTVSIPKPQAVEDKSKERIIQI 178
            |||||||||:  .|..:.| ..||.|.|
Zfish   126 LSSDGVLTVT--GPLKLSD-GPERTIAI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 38/76 (50%)
IbpA <87..179 CDD:223149 43/92 (47%)
cryabbXP_021331756.1 Crystallin 1..48 CDD:306911
ACD_HspB4-5-6 56..137 CDD:107233 38/77 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.