DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hsp27

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:217 Identity:102/217 - (47%)
Similarity:128/217 - (58%) Gaps:27/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLSTLLSLVDELQEPRSPIY------ELGLGLHPHS-----RYVLP--LGTQQRRSINGCPCAS 52
            ||:..||.|..||.......:      :.|.|:|.|.     |.:||  ||..:||       .|
  Fly     1 MSIIPLLHLARELDHDYRTDWGHLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRR-------YS 58

  Fly    53 PICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGK 117
            |...|.  |....:.|..:...:...||   ||||||||||||:||||:||.|||||::::||||
  Fly    59 PYERSH--GHHNQMSRRASGGPNALLPA---VGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGK 118

  Fly   118 HEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVG 182
            ||||:|.||.|.|||||:|.:|.|:...:|||.:|||||||:..|.|.:.|....|||:||||.|
  Fly   119 HEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTG 183

  Fly   183 PAHLNVKANESEV-KGK-ENGA 202
            ||||:|||...|. .|| |||:
  Fly   184 PAHLSVKAPAPEAGDGKAENGS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 52/77 (68%)
IbpA <87..179 CDD:223149 57/91 (63%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 52/76 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452095
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.