DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hsp67Ba

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster


Alignment Length:219 Identity:73/219 - (33%)
Similarity:110/219 - (50%) Gaps:46/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSLVDELQE-PRSPIYEL----GLGLHP-----------------HSRYVLPLGTQQRRS---- 44
            :|.|.:||.: .||...::    |.||:|                 ::...:|:..|...|    
  Fly     7 ILDLAEELHDFNRSLAMDIDDSAGFGLYPLEATSQLPQLSRGLGRGNAMMWVPIKGQSAASQHRH 71

  Fly    45 --INGCPCASPICPSSPAGQVLALRREM-------ANRNDIHWPATAH-----VGKDGFQVCMDV 95
              .|....|...|.:.   .::.|.:|:       |:.:....||.:.     |.::||||.|:|
  Fly    72 HPYNRVAGAKTACCNK---SLVELEKELGDKGTSGASGSTSGQPAASKSAYSVVNRNGFQVSMNV 133

  Fly    96 AQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVS 160
            .||..:||.||.:|:.|:|||:|:|::|.||.|.|||:|:|.:|.||...:|.|.|||||:|||.
  Fly   134 KQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVK 198

  Fly   161 IPKPQAVEDKS---KERIIQIQQV 181
            .|.|..|...|   :|||:.|||:
  Fly   199 APPPLPVVKGSLERQERIVDIQQI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 41/77 (53%)
IbpA <87..179 CDD:223149 48/94 (51%)
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 41/75 (55%)
DNA_pol3_delta2 <218..>381 CDD:331068 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469598
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.