DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hsp67Bc

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster


Alignment Length:194 Identity:73/194 - (37%)
Similarity:102/194 - (52%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IYELGL----GLHPHSRYVLPLGTQQRRSINGCPCASPICPSSPAGQVLALRREMANRNDIHWPA 80
            ::.|||    |.|.|.     |...:|.                 |::.||.|..|:        
  Fly    41 LHTLGLIARMGAHAHH-----LVANKRN-----------------GELAALSRGGAS-------- 75

  Fly    81 TAHVGKDG-FQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKA 144
                .|.| |:|.:||..|:|.||.||:|::.|:||||||||:|||||:.|||||||.:|..:.:
  Fly    76 ----NKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDS 136

  Fly   145 EQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKENGA--PNGK 206
            :.:||.||.||||.:::| |...:::.|||||.|:.|||:.|....|..:..|....|  |..|
  Fly   137 DAIVSTLSEDGVLNITVP-PLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPAASASEPEAK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 43/78 (55%)
IbpA <87..179 CDD:223149 49/92 (53%)
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 43/90 (48%)
IbpA <79..170 CDD:223149 49/91 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469602
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.