DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hsp22

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster


Alignment Length:130 Identity:59/130 - (45%)
Similarity:85/130 - (65%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PATAHVGKDGFQVCMDVAQFKPSELNVKVVDDS-ILVEGKHEERQ-DDHGHIMRHFVRRYKVPDG 141
            |||  |.|||:::.:||..:  |||.|||:|:| :|||||.|::: :..|:..|||:||:.:|:|
  Fly    56 PAT--VNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEG 116

  Fly   142 YKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKENGAPNGK 206
            |:|::|.|.||||||||:|:|.|..|::..|||.:.|:|.|         |...|..|.  ||.|
  Fly   117 YEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTG---------EPAKKSAEE--PNDK 170

  Fly   207  206
              Fly   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 40/79 (51%)
IbpA <87..179 CDD:223149 45/93 (48%)
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 50/101 (50%)
metazoan_ACD 61..138 CDD:107247 40/78 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469605
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.