DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hspb1

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001008615.2 Gene:hspb1 / 368243 ZFINID:ZDB-GENE-030326-4 Length:199 Species:Danio rerio


Alignment Length:165 Identity:55/165 - (33%)
Similarity:85/165 - (51%) Gaps:24/165 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YVLPLGTQQRRSINGCPCASPICPSSPAGQVLALRREMANRNDIHWPATAHVGK--DGFQVCMDV 95
            |:.|.|..:..|:...|...|...:...|:  ||.|::::       ..:.|.:  |.:::.:||
Zfish    53 YMRPFGHPEFASLMQGPPVMPPMMTPSYGR--ALSRQLSS-------GMSEVKQTGDSWKISLDV 108

  Fly    96 AQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVS 160
            ..|.|.|||||..|..:.:.||||||:|:||.|.|.|.|:|.:|.|..:|::.|.||.:|||||.
Zfish   109 NHFSPEELNVKTKDGVLEITGKHEERKDEHGFISRCFTRKYTLPPGVDSEKISSCLSPEGVLTVE 173

  Fly   161 IPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEV 195
            .|.|:..        ||..:|     |:..|::.|
Zfish   174 APLPKPA--------IQAPEV-----NIPVNKTTV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 36/79 (46%)
IbpA <87..179 CDD:223149 40/91 (44%)
hspb1NP_001008615.2 ACD_HspB1_like 91..176 CDD:107230 37/84 (44%)
IbpA <94..191 CDD:223149 43/109 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7249
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4974
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.