DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb9

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001102305.1 Gene:Hspb9 / 363681 RGDID:1309122 Length:203 Species:Rattus norvegicus


Alignment Length:140 Identity:29/140 - (20%)
Similarity:57/140 - (40%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CPSSPAGQVLALRREMAN------RNDIHWPATAHVG---KDGFQVCMDVAQFKPSELNVKVVDD 110
            |||    ..|:.|.:.|.      ::|:   |.||..   :..||:.:|...|.|.:|.|::...
  Rat    58 CPS----VALSERNQAATLPVRLLKDDL---AAAHANGCEEPSFQMKLDAHGFAPEDLVVRIDGQ 115

  Fly   111 SILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERI 175
            :::|.||.::..:|...      .||::......:..:........:|.|:.....:..|.:.:.
  Rat   116 NLMVTGKRQQESNDPSR------GRYRLEQSVHRQMQLPMTLDPAAMTCSLTPSGHLWFKGQNKC 174

  Fly   176 IQI--QQVGP 183
            :.:  .|.||
  Rat   175 LPLPEAQTGP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 15/80 (19%)
IbpA <87..179 CDD:223149 16/93 (17%)
Hspb9NP_001102305.1 ACD_HspB9_like 87..172 CDD:107236 16/90 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342800
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.