DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and CG13133

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster


Alignment Length:138 Identity:48/138 - (34%)
Similarity:75/138 - (54%) Gaps:15/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VGKDGFQVCMDVAQFKPSELNVKVVD-DSILVEGKHEERQDDHGH--IMRHFVRRYKVPDGYKAE 145
            :|:..|:|.:||..|:.|||.||..: |::.||||..:.:.:.|.  |.|.|.|.||:|..|.|.
  Fly    82 LGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDAT 146

  Fly   146 QVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNV------KA-NESEVK---GKEN 200
            |..:..|:||:|.:::|.|..::|  .||.|:|:..|....:|      || .:::|.   |:.|
  Fly   147 QARATFSADGILMITVPAPPKLDD--VEREIEIEPTGNYFGSVSDPTAPKAIEQADVDGDGGEAN 209

  Fly   201 GAPNGKDK 208
            .|....||
  Fly   210 PAGTAMDK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 31/80 (39%)
IbpA <87..179 CDD:223149 36/94 (38%)
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 30/75 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.