DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSPB1

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens


Alignment Length:210 Identity:64/210 - (30%)
Similarity:87/210 - (41%) Gaps:46/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSPIYELGLGLHPHSR--------------------------YVLPLGTQQRRSINGCPCASPIC 55
            |.|.::.....:||||                          ||.||              .|..
Human    12 RGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPL--------------PPAA 62

  Fly    56 PSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEE 120
            ..|||....|..|.::.:.........|.. |.::|.:||..|.|.||.||..|..:.:.|||||
Human    63 IESPAVAAPAYSRALSRQLSSGVSEIRHTA-DRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEE 126

  Fly   121 RQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAH 185
            |||:||:|.|.|.|:|.:|.|....||.|.||.:|.|||..|.|: :..:|.|..|.:.....|.
Human   127 RQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK-LATQSNEITIPVTFESRAQ 190

  Fly   186 LN----VKANESEVK 196
            |.    .|::|:..|
Human   191 LGGPEAAKSDETAAK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 37/77 (48%)
IbpA <87..179 CDD:223149 42/91 (46%)
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 49/136 (36%)
ACD_HspB1_like 84..169 CDD:107230 38/85 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.