DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and CG14207

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster


Alignment Length:114 Identity:38/114 - (33%)
Similarity:51/114 - (44%) Gaps:26/114 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVE 115
            :||:.......:||.||                         .||:|:.|.|:.||.||..:||.
  Fly    91 SSPLIQDEGDNKVLKLR-------------------------FDVSQYAPEEIVVKTVDQKLLVH 130

  Fly   116 GKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKP 164
            .||||:.|... :.|.:.|.:.:|.|...|.:.|.||.||||||..|.|
  Fly   131 AKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 30/77 (39%)
IbpA <87..179 CDD:223149 32/78 (41%)
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452102
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.