DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and cryaba

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_571232.1 Gene:cryaba / 30393 ZFINID:ZDB-GENE-991119-2 Length:168 Species:Danio rerio


Alignment Length:98 Identity:45/98 - (45%)
Similarity:56/98 - (57%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ 150
            :|.|.:.:||..|.|.||.|||.:|.|.:.|||:|||||||.:.|.|.|:||:|.|.....:.|.
Zfish    69 RDRFVINLDVKHFSPDELTVKVNEDFIEIHGKHDERQDDHGIVAREFFRKYKIPAGVDPGAITSS 133

  Fly   151 LSSDGVLTV------------SIP-----KPQA 166
            ||||||||:            |||     ||.|
Zfish   134 LSSDGVLTINTLRHQLDILERSIPIICGEKPPA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 42/93 (45%)
IbpA <87..179 CDD:223149 45/97 (46%)
cryabaNP_571232.1 Crystallin 1..49 CDD:278926
IbpA 11..142 CDD:223149 38/72 (53%)
alpha-crystallin-Hsps_p23-like 64..143 CDD:294116 39/73 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.