DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSPB8

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_055180.1 Gene:HSPB8 / 26353 HGNCID:30171 Length:196 Species:Homo sapiens


Alignment Length:111 Identity:31/111 - (27%)
Similarity:51/111 - (45%) Gaps:25/111 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WPATAHVGK-------------------------DGFQVCMDVAQFKPSELNVKVVDDSILVEGK 117
            ||.|...|.                         :.::||::|..|||.||.||..|..:.|.||
Human    60 WPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGK 124

  Fly   118 HEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPK 163
            |||:|.:.|.:.::|.::.::|.......|.:.||.:|:|.:..|:
Human   125 HEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 27/102 (26%)
IbpA <87..179 CDD:223149 27/77 (35%)
HSPB8NP_055180.1 ACD_HspB8_like 80..170 CDD:107235 26/89 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.