DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hsp16

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_596091.1 Gene:hsp16 / 2540977 PomBaseID:SPBC3E7.02c Length:143 Species:Schizosaccharomyces pombe


Alignment Length:99 Identity:23/99 - (23%)
Similarity:46/99 - (46%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 HVGKDGFQVCMDVAQFKPSELNVK------VVDDSILVEGKHEERQDDHGHIMRH---FVRRYKV 138
            |.|||...|.:::...|..::.|.      .:...::.|.|:|..:.:.....|.   |.|...:
pombe    42 HEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITI 106

  Fly   139 PDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSK 172
            |....|:::.:.. |:|:|||::||.:..:.|.:
pombe   107 PAKIDADRIEANF-SNGLLTVTLPKVEKSQTKKQ 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 19/86 (22%)
IbpA <87..179 CDD:223149 20/95 (21%)
hsp16NP_596091.1 IbpA 1..143 CDD:223149 23/99 (23%)
ACD_sHsps-like 40..130 CDD:107221 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.