DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb1

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_114176.4 Gene:Hspb1 / 24471 RGDID:61306 Length:206 Species:Rattus norvegicus


Alignment Length:216 Identity:68/216 - (31%)
Similarity:92/216 - (42%) Gaps:58/216 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSPIYELGLGLHP-HSR--------------------------YVLPLGTQQRRSINGCPCASPI 54
            |||.:|.....:| |||                          ||.||           |.|:  
  Rat    12 RSPSWEPFRDWYPAHSRLFDQAFGVPRFPDEWSQWFSSAGWPGYVRPL-----------PAAT-- 63

  Fly    55 CPSSPAGQVL-------ALRREMANR-NDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDS 111
             ...||...|       ||.|::::. ::|...|      |.::|.:||..|.|.||.||..:..
  Rat    64 -AEGPAAVTLAAPAFSRALNRQLSSGVSEIRQTA------DRWRVSLDVNHFAPEELTVKTKEGV 121

  Fly   112 ILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERII 176
            :.:.||||||||:||:|.|.|.|:|.:|.|.....|.|.||.:|.|||..|.|:||...::   |
  Rat   122 VEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAE---I 183

  Fly   177 QIQQVGPAHLNVKANESEVKG 197
            .|.....|...:...|||..|
  Rat   184 TIPVTFEARAQIGGPESEQSG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 35/77 (45%)
IbpA <87..179 CDD:223149 40/91 (44%)
Hspb1NP_114176.4 Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:11546764 74..206 51/140 (36%)
ACD_HspB1_like 88..173 CDD:107230 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.