DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb6

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001012401.1 Gene:Hspb6 / 243912 MGIID:2685325 Length:162 Species:Mus musculus


Alignment Length:132 Identity:50/132 - (37%)
Similarity:64/132 - (48%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CPCASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDG--FQVCMDVAQFKPSELNVKVVDD 110
            ||.|  |.|.......:||             .||.|..|.  |.|.:||..|.|.|::||||||
Mouse    46 CPAA--IAPYYLRAPSVAL-------------PTAQVSTDSGYFSVLLDVKHFLPEEISVKVVDD 95

  Fly   111 SILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTV---------SIPKPQA 166
            .:.|..:||||.|:||.|.|.|.|||::|.|.....|.|.||.:|||::         .:|.|.|
Mouse    96 HVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQAQLPSPPA 160

  Fly   167 VE 168
            .:
Mouse   161 AK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 37/88 (42%)
IbpA <87..179 CDD:223149 40/93 (43%)
Hspb6NP_001012401.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 11/40 (28%)
Crystallin 5..56 CDD:278926 5/11 (45%)
ACD_HspB4-5-6 66..148 CDD:107233 38/81 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.