DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb6

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_620242.1 Gene:Hspb6 / 192245 RGDID:621554 Length:162 Species:Rattus norvegicus


Alignment Length:132 Identity:50/132 - (37%)
Similarity:64/132 - (48%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CPCASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDG--FQVCMDVAQFKPSELNVKVVDD 110
            ||.|  |.|.......:||             .||.|..|.  |.|.:||..|.|.|::||||.|
  Rat    46 CPAA--IAPYYLRAPSVAL-------------PTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGD 95

  Fly   111 SILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTV---------SIPKPQA 166
            .:.|..:||||.|:||.|.|.|.|||::|.|.....|.|.||.:|||::         |:|.|.|
  Rat    96 HVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPA 160

  Fly   167 VE 168
            .:
  Rat   161 AK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 37/88 (42%)
IbpA <87..179 CDD:223149 40/93 (43%)
Hspb6NP_620242.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 11/40 (28%)
Crystallin 3..58 CDD:395419 5/13 (38%)
ACD_HspB4-5-6 66..148 CDD:107233 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.