DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and ZK1128.7

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_499252.2 Gene:ZK1128.7 / 191528 WormBaseID:WBGene00014233 Length:205 Species:Caenorhabditis elegans


Alignment Length:106 Identity:36/106 - (33%)
Similarity:55/106 - (51%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEE 120
            |.|| |.| |...|:.|        |:|    ||.:.:||..|.|.|:.|.:.||::.:.|:..|
 Worm    85 PRSP-GPV-AGAGEITN--------TSH----GFTIEIDVFHFMPEEIKVVLTDDTLSISGERFE 135

  Fly   121 RQDDHGHIMRH-FVRRYKVPDGYKAEQVVSQLSSDGVLTVS 160
            ...| ||.:|. |.|:|.:||....:.:.|.|::.|||.::
 Worm   136 STGD-GHTLRRSFSRKYSIPDDVHLDTIRSHLTNSGVLIIN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 26/77 (34%)
IbpA <87..179 CDD:223149 26/75 (35%)
ZK1128.7NP_499252.2 metazoan_ACD 96..178 CDD:107247 30/93 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.