DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Y55F3BR.6

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001368623.1 Gene:Y55F3BR.6 / 190317 WormBaseID:WBGene00021943 Length:253 Species:Caenorhabditis elegans


Alignment Length:173 Identity:48/173 - (27%)
Similarity:76/173 - (43%) Gaps:40/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TQQRRSINGCP-----------------CASPICPSSPAGQVLALRREMANRNDIHWPATAHVGK 86
            ||...:|.|.|                 .:||....|..|.:.::|                |..
 Worm   103 TQTHTAIPGMPDLGNIHSSMLSNFPNLAISSPSVVGSQNGNLTSIR----------------VTN 151

  Fly    87 DGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQL 151
            ..|...:||:::....|.|.|||::|:|||.|.|::|.:|.|...|.||:.:|.....|.|.|||
 Worm   152 TSFHAILDVSKYDADSLKVTVVDNNIIVEGSHGEKEDTYGTIESTFKRRFPLPKAVAPESVQSQL 216

  Fly   152 SSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESE 194
            ::||.||:....|:..::.:  |.|||:.:     |..|.:.:
 Worm   217 TADGHLTIDAKAPEPKQEGA--RPIQIKVI-----NTSAEQQK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 30/77 (39%)
IbpA <87..179 CDD:223149 34/91 (37%)
Y55F3BR.6NP_001368623.1 metazoan_ACD 150..227 CDD:107247 30/76 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.