DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and F08H9.4

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_506586.1 Gene:F08H9.4 / 184215 WormBaseID:WBGene00008592 Length:147 Species:Caenorhabditis elegans


Alignment Length:153 Identity:36/153 - (23%)
Similarity:70/153 - (45%) Gaps:27/153 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LGTQQRRSINGCPCASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPS 101
            :|..|||.:   |.:....|.:...:::       |.|            |.|.|.::|:.|||.
 Worm    22 MGGMQRRLM---PISGTFNPMTDDSEIM-------NSN------------DKFAVNLNVSNFKPE 64

  Fly   102 ELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQA 166
            ||.|.:....:.::|:|:. :::||...:.|.|...:|:......|.:.||:||.|.:..||.:.
 Worm    65 ELKVNLEGRQLSIQGEHDV-ENEHGASRKSFSRMILLPEDVDITSVATNLSNDGKLCIEAPKLEG 128

  Fly   167 VEDKSKERIIQIQQVGPAHLNVK 189
            |..:|    :.:::....|.:::
 Worm   129 VCGRS----VPVKEASMDHHHIE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 23/77 (30%)
IbpA <87..179 CDD:223149 27/91 (30%)
F08H9.4NP_506586.1 metazoan_ACD 47..125 CDD:107247 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.