DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hsp-43

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001123107.2 Gene:hsp-43 / 180895 WormBaseID:WBGene00002024 Length:393 Species:Caenorhabditis elegans


Alignment Length:176 Identity:45/176 - (25%)
Similarity:77/176 - (43%) Gaps:41/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RNDIHW----PATAH-VGKDG-------------FQVCMDVAQFKPSELNVKVVDDSILVEGKHE 119
            |:|.:|    |..|. :.|:|             |.|.||..||:|.|:.||.:||::::||:||
 Worm    80 RSDPYWMNLYPRWAEPIFKEGIDVNSNVVNDDRRFAVDMDCYQFRPEEIQVKTLDDTLMIEGRHE 144

  Fly   120 ERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVG-- 182
            :.:|.......:|||:|::|.......:.|.:.:.|.|.|...|...:..:.:||:|.|:..|  
 Worm   145 DIRDKDNFTKMYFVRKYQLPRDVDFNSIQSSIDAKGRLQVEAGKFNNMALQGRERMIPIEGAGHH 209

  Fly   183 -----------------PAHLNVKANESEVKGKE----NGAPNGKD 207
                             |.|:..:.:...|..:.    |.:|..:|
 Worm   210 SPRFENGTLRSQRGPNSPIHVQTEHDGRSVSSRSGSRLNDSPGSRD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 28/90 (31%)
IbpA <87..179 CDD:223149 31/104 (30%)
hsp-43NP_001123107.2 metazoan_ACD 107..186 CDD:107247 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.