DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hsp-25

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:129 Identity:41/129 - (31%)
Similarity:57/129 - (44%) Gaps:36/129 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEG 116
            ||:......|:.|.||                         .|||.:||.|:.||.:|:.:||..
 Worm   127 SPLIKDESDGKTLRLR-------------------------FDVANYKPEEVTVKTIDNRLLVHA 166

  Fly   117 KHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQ 180
            ||||:.... .:.|.:.:.:.:|.|...||:.|.||:||||||..|.||          :.|||
 Worm   167 KHEEKTPQR-TVFREYNQEFLLPRGTNPEQISSTLSTDGVLTVEAPLPQ----------LAIQQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 29/77 (38%)
IbpA <87..179 CDD:223149 32/91 (35%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.