DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hsp-16.49

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_505356.1 Gene:hsp-16.49 / 179288 WormBaseID:WBGene00002020 Length:143 Species:Caenorhabditis elegans


Alignment Length:75 Identity:23/75 - (30%)
Similarity:43/75 - (57%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 FQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSS 153
            |.|.:||:.|||.:|.:::....:.:|| .:|::.:||:..|.|.:...:|:......|.|.:|:
 Worm    54 FSVQLDVSHFKPEDLKIELDGRELKIEG-IQEKKSEHGYSKRSFSKMILLPEDVDLTSVKSAISN 117

  Fly   154 DGVLTVSIPK 163
            :|.|.:..||
 Worm   118 EGKLQIEAPK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 21/73 (29%)
IbpA <87..179 CDD:223149 23/75 (31%)
hsp-16.49NP_505356.1 IbpA <46..138 CDD:223149 23/75 (31%)
metazoan_ACD 46..127 CDD:107247 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.