powered by:
Protein Alignment Hsp26 and hsp-16.41
DIOPT Version :9
Sequence 1: | NP_001287000.1 |
Gene: | Hsp26 / 39075 |
FlyBaseID: | FBgn0001225 |
Length: | 208 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_872116.2 |
Gene: | hsp-16.41 / 178660 |
WormBaseID: | WBGene00002018 |
Length: | 143 |
Species: | Caenorhabditis elegans |
Alignment Length: | 75 |
Identity: | 24/75 - (32%) |
Similarity: | 42/75 - (56%) |
Gaps: | 1/75 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 FQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSS 153
|.|.:||:.|||..|.:|:....:.:|| .:|.:.:||::.|.|.:...:|:......|.|.:|:
Worm 54 FSVQLDVSHFKPENLKIKLDGRELKIEG-IQETKSEHGYLKRSFSKMILLPEDADLPSVKSAISN 117
Fly 154 DGVLTVSIPK 163
:|.|.:..||
Worm 118 EGKLQIEAPK 127
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160160421 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
67 |
1.000 |
Inparanoid score |
I3937 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR45640 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.900 |
|
Return to query results.
Submit another query.