DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hsp-16.2

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001379929.1 Gene:hsp-16.2 / 178659 WormBaseID:WBGene00002016 Length:145 Species:Caenorhabditis elegans


Alignment Length:129 Identity:39/129 - (30%)
Similarity:66/129 - (51%) Gaps:22/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEG 116
            :|:|..||:..     .|:.| ||           ..|.:.::|:||||.:|.:.:...::.::|
 Worm    30 APVCRISPSES-----SEIVN-ND-----------QKFAINLNVSQFKPEDLKINLDGRTLSIQG 77

  Fly   117 KHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQ 180
            : :|.:.|||:..:.|.|...:|:......|.|.||.||.|::..||.:||:.:|    |.|||
 Worm    78 E-QELKTDHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKKEAVQGRS----IPIQQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 22/77 (29%)
IbpA <87..179 CDD:223149 28/91 (31%)
hsp-16.2NP_001379929.1 metazoan_ACD 42..123 CDD:107247 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160440
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.