DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and sip-1

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_499316.1 Gene:sip-1 / 176471 WormBaseID:WBGene00004798 Length:159 Species:Caenorhabditis elegans


Alignment Length:132 Identity:36/132 - (27%)
Similarity:55/132 - (41%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SPICP--SSPAG---------QVLALRREMANR---------NDIHWPATAHVGKDGFQVCMDVA 96
            |.:||  ..|.|         ...|.|..|.|.         |::...|      ..|.|.:|||
 Worm     2 SSLCPYTGRPTGLFRDFEDMMPYWAQRHSMLNNFNNIVPQQLNEVENTA------QKFCVKLDVA 60

  Fly    97 QFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSI 161
            .|||.||.|.:....:.:||.||.: .:||...|.|.|::.:|.......:.:.::.:|.:|:..
 Worm    61 AFKPEELKVNLEGHVLTIEGHHEVK-TEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDA 124

  Fly   162 PK 163
            ||
 Worm   125 PK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 23/77 (30%)
IbpA <87..179 CDD:223149 25/77 (32%)
sip-1NP_499316.1 IbpA <45..129 CDD:223149 26/89 (29%)
metazoan_ACD 45..126 CDD:107247 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.