DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hsp-12.2

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_498776.1 Gene:hsp-12.2 / 176148 WormBaseID:WBGene00002011 Length:110 Species:Caenorhabditis elegans


Alignment Length:93 Identity:35/93 - (37%)
Similarity:49/93 - (52%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WP-------ATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRR 135
            ||       ...|..|:.|:|.:||..|.|.|:.|||....:|:..:||.|.|:||.:.|...|.
 Worm    16 WPLQHNDGVVKVHNTKEKFEVGLDVQFFTPKEIEVKVSGQELLIHCRHETRSDNHGTVAREINRA 80

  Fly   136 YKVPDGYKAEQVVSQLSSDGVLTVSIPK 163
            ||:||......|.|.|::.||||::..|
 Worm    81 YKLPDDVDVSTVKSHLATRGVLTITASK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 31/77 (40%)
IbpA <87..179 CDD:223149 31/77 (40%)
hsp-12.2NP_498776.1 metazoan_ACD 26..108 CDD:107247 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.