DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb2

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_569115.1 Gene:Hspb2 / 161476 RGDID:70914 Length:182 Species:Rattus norvegicus


Alignment Length:127 Identity:37/127 - (29%)
Similarity:55/127 - (43%) Gaps:31/127 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PATAHVGKDG-------------FQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMR 130
            |..|..|:.|             ||..:||:.|.|.|:.|:.||:.:.|..:|.:|.|.||.:.|
  Rat    51 PRAARAGEGGRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSR 115

  Fly   131 HFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANE 192
            .|.|.|.:|......:|.:.||.||:|.:..|:                  |..||:.:.||
  Rat   116 EFCRTYVLPADVDPWRVRAALSHDGILNLEAPR------------------GGRHLDTEVNE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 29/90 (32%)
IbpA <87..179 CDD:223149 29/104 (28%)
Hspb2NP_569115.1 Crystallin <16..51 CDD:395419 37/127 (29%)
alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.710

Return to query results.
Submit another query.