DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb1

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_038588.2 Gene:Hspb1 / 15507 MGIID:96240 Length:209 Species:Mus musculus


Alignment Length:207 Identity:70/207 - (33%)
Similarity:97/207 - (46%) Gaps:37/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSPIYELGLGLHP-HSRYV--------LPLGTQQRRSINGCPCASPICPSS----PAGQVL---- 64
            |||.:|.....:| |||..        ||....|..|..|.|......|::    ||...|    
Mouse    12 RSPSWEPFRDWYPAHSRLFDQAFGVPRLPDEWSQWFSAAGWPGYVRPLPAATAEGPAAVTLAAPA 76

  Fly    65 ---ALRREMANR-NDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDH 125
               ||.|::::. ::|...|      |.::|.:||..|.|.||.||..:..:.:.||||||||:|
Mouse    77 FSRALNRQLSSGVSEIRQTA------DRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEH 135

  Fly   126 GHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERI-----IQIQQVGPAH 185
            |:|.|.|.|:|.:|.|.....|.|.||.:|.|||..|.|:||...::..|     .:.|..||  
Mouse   136 GYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGP-- 198

  Fly   186 LNVKANESEVKG 197
               :|.:||..|
Mouse   199 ---EAGKSEQSG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 35/77 (45%)
IbpA <87..179 CDD:223149 40/96 (42%)
Hspb1NP_038588.2 Interaction with TGFB1I1. /evidence=ECO:0000250 74..209 52/145 (36%)
ACD_HspB1_like 88..173 CDD:107230 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.