DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and CRYAB

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001276736.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens


Alignment Length:93 Identity:48/93 - (51%)
Similarity:57/93 - (61%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ 150
            ||.|.|.:||..|.|.||.|||:.|.|.|.||||||||:||.|.|.|.|:|::|.......:.|.
Human    72 KDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSS 136

  Fly   151 LSSDGVLTVSIPKPQAVEDKSKERIIQI 178
            |||||||||:.|:.|.   ...||.|.|
Human   137 LSSDGVLTVNGPRKQV---SGPERTIPI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 42/76 (55%)
IbpA <87..179 CDD:223149 47/92 (51%)
CRYABNP_001276736.1 Crystallin 1..52 CDD:395419
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 43/77 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.