DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and CRYAA

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_000385.1 Gene:CRYAA / 1409 HGNCID:2388 Length:173 Species:Homo sapiens


Alignment Length:96 Identity:42/96 - (43%)
Similarity:57/96 - (59%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ 150
            :|.|.:.:||..|.|.:|.|||.||.:.:.|||.|||||||:|.|.|.|||::|.......:...
Human    68 RDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCS 132

  Fly   151 LSSDGVLTVSIPKPQAVEDKS-KERIIQIQQ 180
            ||:||:||...||.|...|.: .||.|.:.:
Human   133 LSADGMLTFCGPKIQTGLDATHAERAIPVSR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 35/76 (46%)
IbpA <87..179 CDD:223149 42/92 (46%)
CRYAANP_000385.1 Crystallin 1..51 CDD:395419
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 35/76 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148916
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.