DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Cryab

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001276711.1 Gene:Cryab / 12955 MGIID:88516 Length:175 Species:Mus musculus


Alignment Length:93 Identity:48/93 - (51%)
Similarity:57/93 - (61%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ 150
            ||.|.|.:||..|.|.||.|||:.|.|.|.||||||||:||.|.|.|.|:|::|.......:.|.
Mouse    72 KDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSS 136

  Fly   151 LSSDGVLTVSIPKPQAVEDKSKERIIQI 178
            |||||||||:.|:.|.   ...||.|.|
Mouse   137 LSSDGVLTVNGPRKQV---SGPERTIPI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 42/76 (55%)
IbpA <87..179 CDD:223149 47/92 (51%)
CryabNP_001276711.1 Crystallin 1..52 CDD:395419
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 43/77 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..175 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.