DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AgaP_AGAP007158

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_308610.4 Gene:AgaP_AGAP007158 / 1269956 VectorBaseID:AGAP007158 Length:207 Species:Anopheles gambiae


Alignment Length:148 Identity:62/148 - (41%)
Similarity:89/148 - (60%) Gaps:22/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 REMANRNDIHWPAT-----------AHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEER 121
            ::..||.:..|.::           .::.||.||:.:||.||.|.|::||.||:.:||||||||:
Mosquito    57 QQSGNRYNRPWHSSCIARMHDSGSAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEK 121

  Fly   122 QDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHL 186
            |||||::.|||||||.:|.|:....:||.|||||:||::.|:.: :|.|.:||.|.|...|..  
Mosquito   122 QDDHGYVSRHFVRRYMLPKGHNEADIVSSLSSDGILTITCPRKE-IEQKKEERSIPITHTGQP-- 183

  Fly   187 NVKANESEVKGK---ENG 201
                 ..:|.||   |||
Mosquito   184 -----MKQVTGKAAQENG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 45/77 (58%)
IbpA <87..179 CDD:223149 50/91 (55%)
AgaP_AGAP007158XP_308610.4 Crystallin <18..45 CDD:278926
IbpA <81..177 CDD:223149 51/96 (53%)
metazoan_ACD 82..163 CDD:107247 45/80 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 115 1.000 Domainoid score I11772
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.