DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AgaP_AGAP007160

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_001688033.1 Gene:AgaP_AGAP007160 / 1269954 VectorBaseID:AGAP007160 Length:184 Species:Anopheles gambiae


Alignment Length:116 Identity:49/116 - (42%)
Similarity:66/116 - (56%) Gaps:20/116 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKA 144
            |.....:|.||:.:||.||.|.|:.|:..|..:.:||||||::|:.|::.|.|.|||.||.||.|
Mosquito    66 AKVDTDRDRFQIELDVHQFLPHEVTVRRTDKYVTIEGKHEEKRDEQGYVARQFSRRYLVPIGYDA 130

  Fly   145 EQVVSQLSSDGVLTVSIP-------------------KPQAVEDKSKERII 176
            ..:||.|||||||||:.|                   || |:|||:..|.:
Mosquito   131 NLIVSSLSSDGVLTVTAPRIGLPAPKVEKYVPIWHTGKP-AIEDKNSRRCL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 41/96 (43%)
IbpA <87..179 CDD:223149 48/109 (44%)
AgaP_AGAP007160XP_001688033.1 metazoan_ACD 67..149 CDD:107247 40/81 (49%)
IbpA <69..163 CDD:223149 41/93 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.