DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AgaP_AGAP007161

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_308607.3 Gene:AgaP_AGAP007161 / 1269953 VectorBaseID:AGAP007161 Length:206 Species:Anopheles gambiae


Alignment Length:118 Identity:56/118 - (47%)
Similarity:77/118 - (65%) Gaps:3/118 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQL 151
            |..|:.:||.||.|.|:.||.|::||:|||||||:||:||.|.|||||||.:||.:..:.|:|.|
Mosquito    88 DRLQINLDVQQFTPHEITVKTVNNSIVVEGKHEEKQDEHGFIARHFVRRYVLPDDHDPKDVISSL 152

  Fly   152 SSDGVLTVSIPK--PQAVEDKSKERIIQIQQVGPAHL-NVKANESEVKGKENG 201
            |||||||:..||  ||...:...||.:.||::....: :|:.....|..:.||
Mosquito   153 SSDGVLTIVAPKKVPQPAPEAVYERTVPIQRIEERTVESVRTTSESVTSESNG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 44/75 (59%)
IbpA <87..179 CDD:223149 50/93 (54%)
AgaP_AGAP007161XP_308607.3 Crystallin <24..54 CDD:278926
IbpA <88..182 CDD:223149 50/93 (54%)
metazoan_ACD 88..164 CDD:107247 44/75 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.