Protein Alignment Hsp26 and HSPB6

DIOPT Version :9

• Sequence 1: NP_001287000.1
• Gene: Hsp26 / 39075
• FlyBaseID: FBgn0001225
• Length: 208
• Species: Drosophila melanogaster
• Sequence 2: NP_653218.1
• Gene: HSPB6 / 126393
• HGNCID: 26511
• Length: 160
• Species: Homo sapiens
• Alignment Length: 87
• Identity: 36/87 - (41%)
• Similarity: 49/87 - (56%)
• Gaps: 7/87 - (8%)

  Fly    89 FQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSS 153
            |.|.:||..|.|.|:.||||.:.:.|..:||||.|:||.:.|.|.|||::|.|.....|.|.||.
Human    74 FSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSP 138

  Fly   154 DGVLTV-------SIPKPQAVE 168
            :|||::       ..|.|.|.:
Human   139 EGVLSIQAAPASAQAPPPAAAK 160

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Hsp26	NP_001287000.1	metazoan_ACD	85..163	CDD:107247	33/80 (41%)
		IbpA	<87..179	CDD:223149	36/87 (41%)
HSPB6	NP_653218.1	Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000269|PubMed:27717639	1..72
		Crystallin	3..58	CDD:395419
		ACD_HspB4-5-6	66..144	CDD:107233	33/69 (48%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1187096at2759
OrthoFinder	1	1.000	-	-		FOG0000383
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR45640
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	5	5.020