DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb8

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_446064.1 Gene:Hspb8 / 113906 RGDID:71003 Length:196 Species:Rattus norvegicus


Alignment Length:111 Identity:31/111 - (27%)
Similarity:51/111 - (45%) Gaps:25/111 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WPATAHVGK-------------------------DGFQVCMDVAQFKPSELNVKVVDDSILVEGK 117
            ||.|...|.                         :.::||::|..|||.||.||..|..:.|.||
  Rat    60 WPGTLRSGMVPRGPTATARFGVPAEGRNPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGK 124

  Fly   118 HEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPK 163
            |||:|.:.|.:.::|.::.::|.......|.:.||.:|:|.:..|:
  Rat   125 HEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 27/102 (26%)
IbpA <87..179 CDD:223149 27/77 (35%)
Hspb8NP_446064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
ACD_HspB8_like 80..170 CDD:107235 26/89 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.