Sequence 1: | NP_001287000.1 | Gene: | Hsp26 / 39075 | FlyBaseID: | FBgn0001225 | Length: | 208 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001300979.1 | Gene: | CRYAA2 / 102724652 | -ID: | - | Length: | 173 | Species: | Homo sapiens |
Alignment Length: | 96 | Identity: | 42/96 - (43%) |
---|---|---|---|
Similarity: | 57/96 - (59%) | Gaps: | 1/96 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 KDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ 150
Fly 151 LSSDGVLTVSIPKPQAVEDKS-KERIIQIQQ 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp26 | NP_001287000.1 | metazoan_ACD | 85..163 | CDD:107247 | 35/76 (46%) |
IbpA | <87..179 | CDD:223149 | 42/92 (46%) | ||
CRYAA2 | NP_001300979.1 | Crystallin | 1..51 | CDD:395419 | |
ACD_alphaA-crystallin_HspB4 | 60..145 | CDD:107245 | 35/76 (46%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148915 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1187096at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000383 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45640 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6558 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.880 |