powered by:
Protein Alignment Hsp26 and LOC101732374
DIOPT Version :9
Sequence 1: | NP_001287000.1 |
Gene: | Hsp26 / 39075 |
FlyBaseID: | FBgn0001225 |
Length: | 208 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031754874.1 |
Gene: | LOC101732374 / 101732374 |
-ID: | - |
Length: | 755 |
Species: | Xenopus tropicalis |
Alignment Length: | 55 |
Identity: | 16/55 - (29%) |
Similarity: | 19/55 - (34%) |
Gaps: | 9/55 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 SPIYELGLGLHPHSRYVLPLGTQQRRSINGCPCAS--------PICPSSPAGQVL 64
||.|.|.....|...|.: |||.:..|:...|..| .|.|....|..|
Frog 101 SPSYGLYSAFFPILTYFI-LGTSRHISVGPFPVLSLMVGTAVLKIVPEGSNGTTL 154
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Hsp26 | NP_001287000.1 |
metazoan_ACD |
85..163 |
CDD:107247 |
|
IbpA |
<87..179 |
CDD:223149 |
|
LOC101732374 | XP_031754874.1 |
sulP |
59..706 |
CDD:273284 |
16/55 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165168123 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.