DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hspb2

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_002932983.1 Gene:hspb2 / 100497635 XenbaseID:XB-GENE-940436 Length:179 Species:Xenopus tropicalis


Alignment Length:185 Identity:46/185 - (24%)
Similarity:75/185 - (40%) Gaps:56/185 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PRSPIYE-----------LGLGLHP---------HSRYVLP-LGTQQRRSINGCPCASPICPSSP 59
            |.|..||           .|.|:.|         |..|:.| :..|..|..:             
 Frog    11 PMSAEYEFANPTKIFDQNFGEGISPEDLLCPTLYHGYYIRPRINKQTDRGFS------------- 62

  Fly    60 AGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDD 124
                      ..|||:           ..|||.:||..|.|.|::|..:|:.:.|..||.::.|.
 Frog    63 ----------EINRNE-----------HKFQVFLDVCHFLPDEISVHTMDNLLEVSAKHPQKIDS 106

  Fly   125 HGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQ 179
            ||.:.|.|.|:|.:|.......|.::||.||:|::..|:.: |:.|.:..:::|:
 Frog   107 HGFVSRSFNRKYILPLDVDPLLVKAKLSHDGILSIEAPRKE-VDLKGENNVVKIK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 27/77 (35%)
IbpA <87..179 CDD:223149 30/91 (33%)
hspb2XP_002932983.1 Crystallin <21..51 CDD:278926 5/29 (17%)
IbpA <63..149 CDD:223149 31/97 (32%)
alpha-crystallin-Hsps_p23-like 69..145 CDD:294116 27/75 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.