DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hspb6

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:132 Identity:53/132 - (40%)
Similarity:67/132 - (50%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SPICPSSPAGQVLALRREMANRNDIHWPATA-----HVGKDGFQVCMDVAQFKPSELNVKVVDDS 111
            |.:.|:.|  ..:||.........|..|:.|     .:.||.|.|.:||..|.|.||.||||.|.
 Frog    36 SELFPAMP--MPMALSPYYYRSPSIPQPSEAGLSEVKLDKDQFSVLLDVKHFSPEELTVKVVGDY 98

  Fly   112 ILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERII 176
            :.|..|||||.|:||.|.|.|.||||:|.......:.|.||::|:|  ||..|.....|.:||.|
 Frog    99 VEVHAKHEERPDEHGFISREFHRRYKIPPTVSPAAISSALSAEGLL--SIQAPVTAGGKQEERSI 161

  Fly   177 QI 178
            .|
 Frog   162 PI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 39/77 (51%)
IbpA <87..179 CDD:223149 44/92 (48%)
hspb6XP_002940672.2 Crystallin 1..56 CDD:366148 5/21 (24%)
ACD_HspB4-5-6 68..149 CDD:107233 39/82 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.