DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hsp30d

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_002937646.1 Gene:hsp30d / 100489362 XenbaseID:XB-GENE-5917036 Length:215 Species:Xenopus tropicalis


Alignment Length:200 Identity:55/200 - (27%)
Similarity:81/200 - (40%) Gaps:61/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CPCASPICPSSPA-----GQ----VLALRREMANR----NDIH---------------------- 77
            |||:.|.....||     ||    :|::|.:|..|    |:.:                      
 Frog    15 CPCSQPALTLWPATRLILGQLGDDILSMRNDMERRMQCVNEAYRLLSQDMDMRRITDQSRQPRAA 79

  Fly    78 -----WPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQD----DHGHIMRHFV 133
                 .|::...|||.|::.:||..|.|.||.||:....::|.||.|.:.|    .:.|..|.:.
 Frog    80 ETEGTSPSSGKDGKDHFELTLDVRDFSPHELTVKMQGRRVIVTGKQERKSDSEDGSYFHEYREWK 144

  Fly   134 RRYKVPDGYKAEQVVSQLSSDGVLTVSIPK---PQAVEDKSKERIIQI---------QQVGPAHL 186
            |..::|:|...||||...|.||.|.:..|:   |.|     .||.|.|         |::.|...
 Frog   145 REAELPEGVNPEQVVCSFSKDGHLHIQAPRLALPPA-----PERPIPISMDPAPRDAQEIPPDAQ 204

  Fly   187 NVKAN 191
            |..|:
 Frog   205 NSNAD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 30/81 (37%)
IbpA <87..179 CDD:223149 35/107 (33%)
hsp30dXP_002937646.1 ACD_HspB9_like 88..174 CDD:107236 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.