DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and LOC100489207

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_012822866.2 Gene:LOC100489207 / 100489207 -ID:- Length:206 Species:Xenopus tropicalis


Alignment Length:211 Identity:55/211 - (26%)
Similarity:84/211 - (39%) Gaps:60/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LHPHSRYVLPLGTQQRRSINGCPCASPICPSSPAGQ----VLALRREMANR------------ND 75
            |.|...|:             |||:.|..  :..||    :|::|::|..|            .|
 Frog     8 LQPSKAYL-------------CPCSQPAL--TLFGQLGDDILSMRKDMVRRRQHVNEACELLFQD 57

  Fly    76 IHW-------------------PATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEER 121
            :..                   |::...|||.|::.:||..|.|.|:.||.....::|.||||.:
 Frog    58 MDMRRITDQSRQPRATETEGTSPSSDKDGKDHFELMLDVGDFSPHEITVKTQGRRVIVTGKHERK 122

  Fly   122 QD----DHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIP---KPQAVEDK---SKERII 176
            .|    .:.|..|.:.||.::|:|...||||..||.||.|.:..|   .|.|.|..   |.....
 Frog   123 SDSEDGSYVHEYREWNRRAELPEGVNLEQVVCSLSKDGHLHIKAPWLALPPAPERPIPISMNMAP 187

  Fly   177 QIQQVGPAHLNVKANE 192
            .:.|..| :.|.:.::
 Frog   188 SVAQPMPXNSNAEGDQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 33/84 (39%)
IbpA <87..179 CDD:223149 35/101 (35%)
LOC100489207XP_012822866.2 ACD_HspB9_like 82..167 CDD:107236 32/84 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.