DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and cryaa

DIOPT Version :10

Sequence 1:NP_523997.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_031752202.1 Gene:cryaa / 100488185 XenbaseID:XB-GENE-5940571 Length:115 Species:Xenopus tropicalis


Alignment Length:96 Identity:41/96 - (42%)
Similarity:59/96 - (61%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQ 150
            :|.|.:.:||..|.|.:|:||:.||.:.:.|||.|||||||:|.|.|.|||::|.......|...
 Frog    12 RDRFFINLDVKHFSPEDLSVKLHDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQNSVSCT 76

  Fly   151 LSSDGVLTVSIPKPQA-VEDKSKERIIQIQQ 180
            ||:||:|:.|.||.|. |:....:|.|.:.:
 Frog    77 LSADGILSFSGPKLQPNVDSSHSDRTIPVSR 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_523997.1 metazoan_ACD 85..163 CDD:107247 35/76 (46%)
cryaaXP_031752202.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 5..89 CDD:469641 35/76 (46%)

Return to query results.
Submit another query.