DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and si:dkey-1k23.3

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:124 Identity:45/124 - (36%)
Similarity:67/124 - (54%) Gaps:20/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 FQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSS 153
            :::.:||..|.|:|::||:....:.:.||||||||.||.|.|.|.|:|.:|.|.:.|.:.:.||:
Zfish    99 WKISLDVNHFAPAEISVKIQHGFLEIAGKHEERQDGHGFIARSFTRKYNLPGGIEVENLQTSLSA 163

  Fly   154 DGVLTV-----SIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKENGAPNGKD 207
            ||:|||     |||.|..|       ||.||        |::....:.||:......:|
Zfish   164 DGILTVEAPFPSIPLPADV-------IIPIQ--------VESGAQTIAGKQQDGDKPQD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 34/78 (44%)
IbpA <87..179 CDD:223149 39/94 (41%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin-Hsps_p23-like 88..172 CDD:320797 32/72 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7249
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.