DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and AT1G59860

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_176195.1 Gene:AT1G59860 / 842280 AraportID:AT1G59860 Length:155 Species:Arabidopsis thaliana


Alignment Length:183 Identity:39/183 - (21%)
Similarity:66/183 - (36%) Gaps:57/183 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVPTTY----RDLSREFDRLRPLYHPPYDFQLYPYLWDDSRLWWPSPHTSRSDLLRPLDELVS 61
            |||:|:.:    |..:..||        |:...    :||                  |..||..
plant     1 MSLIPSFFGNNRRINNNIFD--------PFSLD----VWD------------------PFKELQF 35

  Fly    62 RRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVI-VQG 125
            ....:..|.:...:|...         ...||    |:.|:.  .....::.|:..||.|: :.|
plant    36 PSSSSSAIANARVDWKET---------AEAHV----FKADLP--GMKKEEVKVEIEDDSVLKISG 85

  Fly   126 -NHNRRDEGSN--GLVERH---FVRKYLLPRGYNANEVISDISSDGILTIKAP 172
             .|..::|..:  ..|||.   |.||:.||.....::|.:.: .:|:||:..|
plant    86 ERHVEKEEKQDTWHRVERSSGGFSRKFRLPENVKMDQVKASM-ENGVLTVTVP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 20/81 (25%)
AT1G59860NP_176195.1 ACD_ScHsp26_like 47..138 CDD:107229 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.