DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and AT1G54050

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001323264.1 Gene:AT1G54050 / 841843 AraportID:AT1G54050 Length:155 Species:Arabidopsis thaliana


Alignment Length:98 Identity:29/98 - (29%)
Similarity:45/98 - (45%) Gaps:21/98 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 HVDEKGF-RIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRD----EGSNGL-VER----HFVRKY 146
            ::|..|. :.||.|.......:|:|:|       |...|.|    |||..: :||    :.|:|:
plant    56 YLDIPGISKSDIQVTVEEERTLVIKSN-------GKRKRDDDESEEGSKYIRLERRLAQNLVKKF 113

  Fly   147 LLPRGYNANEVISDISSDGILTI---KAPPPPP 176
            .||...:...|.:.. .:|:||:   |.||.||
plant   114 RLPEDADMASVTAKY-QEGVLTVVIKKLPPQPP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 23/84 (27%)
AT1G54050NP_001323264.1 ACD_sHsps-like 45..137 CDD:107221 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.