DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and AT1G53540

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_175759.1 Gene:AT1G53540 / 841789 AraportID:AT1G53540 Length:157 Species:Arabidopsis thaliana


Alignment Length:194 Identity:39/194 - (20%)
Similarity:69/194 - (35%) Gaps:63/194 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVPTTYRD-LSREFDRLRPLYHPPYDFQLYP-----------YLWDDSRLWW---PSPHTSRS 50
            |||:|:.:.. .:..||........|::..|.|           ..:.::::.|   |..|..::
plant     1 MSLIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAPAMDVAAFTNAKVDWRETPEAHVFKA 65

  Fly    51 DLLRPLDELVSRRVRN-QLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVV 114
            ||.....|.|...|.: .::|               .||||.:.:|                   
plant    66 DLPGLRKEEVKVEVEDGNILQ---------------ISGERSNENE------------------- 96

  Fly   115 KTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAK 178
            :.||.:        .|.|.|:|    .|.|::.||......|:.:.: .:|:|::..|..|..|
plant    97 EKNDKW--------HRVERSSG----KFTRRFRLPENAKMEEIKASM-ENGVLSVTVPKVPEKK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 14/74 (19%)
AT1G53540NP_175759.1 IbpA 11..156 CDD:223149 35/184 (19%)
ACD_ScHsp26_like 51..142 CDD:107229 27/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.