DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and HSP18.2

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_200780.1 Gene:HSP18.2 / 836093 AraportID:AT5G59720 Length:161 Species:Arabidopsis thaliana


Alignment Length:190 Identity:42/190 - (22%)
Similarity:70/190 - (36%) Gaps:53/190 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVPTTYRD-LSREFDRLRPLYHPPYDFQLYPY---LWDD-SRLWWPSPHTSRSDLLRPLDELV 60
            |||:|:.:.. .|..||               |:   |||. ...:.||...:.:...|.:....
plant     1 MSLIPSIFGGRRSNVFD---------------PFSQDLWDPFEGFFTPSSALANASTARDVAAFT 50

  Fly    61 SRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVI-VQ 124
            :.||          :|...         ...||    |:.|:.  .....::.|:..|..|: :.
plant    51 NARV----------DWKET---------PEAHV----FKADLP--GLKKEEVKVEVEDKNVLQIS 90

  Fly   125 GNHNRRDEGSNG---LVER---HFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAK 178
            |..::.:|..|.   .|||   .|:|::.||......||.:.: .:|:||:..|..|..|
plant    91 GERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATM-ENGVLTVVVPKAPEKK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 19/81 (23%)
HSP18.2NP_200780.1 ACD_ScHsp26_like 53..144 CDD:107229 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.