DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and AT5G51440

DIOPT Version :10

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_199957.1 Gene:AT5G51440 / 835218 AraportID:AT5G51440 Length:210 Species:Arabidopsis thaliana


Alignment Length:133 Identity:26/133 - (19%)
Similarity:55/133 - (41%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFH 108
            :|..|.|.:|..:|::    ....|:.:|....|..:|     .|..|...:....:.||:....
plant    75 TPTRSLSQMLNFMDQV----SEIPLVSATRGMGASGVR-----RGWNVKEKDDALHLRIDMPGLS 130

  Fly   109 PHDIVVKTNDDYVIVQG---NHNRRDEGSNGLVERHFVRKYLLP-RGYNANEVISDISSDGILTI 169
            ..|:.:....:.::::|   .....|...:|   |.|..:..|| :.|..:|:.::: .:|:|.:
plant   131 REDVKLALEQNTLVIRGEGETEEGEDVSGDG---RRFTSRIELPEKVYKTDEIKAEM-KNGVLKV 191

  Fly   170 KAP 172
            ..|
plant   192 VIP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 14/78 (18%)
AT5G51440NP_199957.1 ACD_sHsps-like 112..195 CDD:107221 16/87 (18%)

Return to query results.
Submit another query.