DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and AT5G51440

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_199957.1 Gene:AT5G51440 / 835218 AraportID:AT5G51440 Length:210 Species:Arabidopsis thaliana


Alignment Length:131 Identity:26/131 - (19%)
Similarity:57/131 - (43%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFH 108
            :|..|.|.:|..:|::    ....|:.:|....|..:|     .|..|...:....:.||:....
plant    75 TPTRSLSQMLNFMDQV----SEIPLVSATRGMGASGVR-----RGWNVKEKDDALHLRIDMPGLS 130

  Fly   109 PHDIVVKTNDDYVIVQGNHNRRDEGSNGLVE-RHFVRKYLLP-RGYNANEVISDISSDGILTIKA 171
            ..|:.:....:.::::| ....:||.:...: |.|..:..|| :.|..:|:.::: .:|:|.:..
plant   131 REDVKLALEQNTLVIRG-EGETEEGEDVSGDGRRFTSRIELPEKVYKTDEIKAEM-KNGVLKVVI 193

  Fly   172 P 172
            |
plant   194 P 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 14/76 (18%)
AT5G51440NP_199957.1 ACD_sHsps-like 112..195 CDD:107221 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.