DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and AT5G37670

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_198583.1 Gene:AT5G37670 / 833746 AraportID:AT5G37670 Length:137 Species:Arabidopsis thaliana


Alignment Length:133 Identity:28/133 - (21%)
Similarity:53/133 - (39%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 EWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLV- 138
            ||:......::......|:      ..|:|..::..||.|:..:..|:.......::|....|| 
plant    16 EWSRSTALIDWMESNNSHI------FKINVPGYNKEDIKVQIEEGNVLSIRGEGIKEEKKENLVW 74

  Fly   139 ---ER--------HFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHET 192
               ||        .|:|:..||.....::|.:.: .:|:||:..|....:|    ..::..|:.|
plant    75 HVAEREAFSGGGSEFLRRIELPENVKVDQVKAYV-ENGVLTVVVPKDTSSK----SSKVRNVNIT 134

  Fly   193 GKL 195
            .||
plant   135 SKL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 18/86 (21%)
AT5G37670NP_198583.1 ACD_ScHsp26_like 24..119 CDD:107229 20/101 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.